PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_D9BA83221.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 368aa    MW: 39753.8 Da    PI: 6.3231
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_D9BA83221.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1482.6e-15256299548
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                            +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lkk+
  Traes_1DL_D9BA83221.2 256 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKKQ 299
                            79***************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.5E-13252321IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.702254299IPR004827Basic-leucine zipper domain
PfamPF001703.0E-13256299IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-12256302No hitNo description
Gene3DG3DSA:1.20.5.1702.0E-15256299No hitNo description
CDDcd147073.85E-25256300No hitNo description
PROSITE patternPS000360259274IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MIQAMASQSQ AGGGGGGYAG PGQHGQAQGL ARQGSLYSLT LDEVQSQLTE PLLSMNLDEL  60
LKSVFPDGVD PVGGVAGQSE PALGLHRQGS ITMPPELSKK TVDEVWKGIQ DSPKRSGEEG  120
SQRRRERQPT FGEMTLEDFL VKAGVVAEGH LKDLIDLPAN MGAVGRSVIE AAAPSLNPGA  180
HWLQQYLEPQ HPSMAGPFMA SHLGPQPLSV ATGAIMEPIY PDGQITSPML DALSDPQTPR  240
RKRGASDGVT DKVVERRQKR MIKNRESAAR SRARKQAYTN ELENKVSRLE EENERLKKQK  300
GVGHDDNLRA SPRTQVSTPE NKFCSCLTSI VNFVDYTAHM FSVVVVETVG SLRCCSLSQP  360
GGSEFVDE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1110115DSPKRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU3071120.0EU307112.2 Triticum aestivum FD-like 2 protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568219.11e-144PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_014753472.11e-144PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES33e-68AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLW5AIV20.0W5AIV2_WHEAT; Uncharacterized protein
STRINGMLOC_6534.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.12e-62ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]